PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020777.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 237aa    MW: 27479.6 Da    PI: 5.1841
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020777.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.23.7e-131562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W +eEdell   v++ G+++W++ a++ g++R++ +c+ rw++yl
      Pbr020777.1 15 KGLWLEEEDELLTTFVNLKGNRRWDALAKESGLRRSGRSCRMRWLNYL 62
                     678*******************************************97 PP

2Myb_DNA-binding45.32e-1475113848
                      HHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   8 EdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      E++ ++++++++G++ W++Iar ++ gRt++++k++w+++l
      Pbr020777.1  75 EEKTILQLHQRWGNK-WSKIARALP-GRTDNEIKNYWRTHL 113
                      99*************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.5771062IPR017930Myb domain
SuperFamilySSF466894.97E-2513109IPR009057Homeodomain-like
SMARTSM007172.2E-111464IPR001005SANT/Myb domain
PfamPF002498.8E-121562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-171669IPR009057Homeodomain-like
PROSITE profilePS5129421.91463117IPR017930Myb domain
SMARTSM007178.6E-1267115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-2270116IPR009057Homeodomain-like
PfamPF002495.2E-1375113IPR001005SANT/Myb domain
CDDcd001671.56E-975113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MMACQAAMDG EKLRKGLWLE EEDELLTTFV NLKGNRRWDA LAKESGLRRS GRSCRMRWLN  60
YLHPNVKHGQ ITIIEEKTIL QLHQRWGNKW SKIARALPGR TDNEIKNYWR THLKKKTQIP  120
DGNFQCTLNK NGRGLFCQEG DMNNEKYDFD QDHDSVKNSW ETKVTSSDDL CLSDFAVTNS  180
PYETQLSDWI SELSSEQNGT AYNQDCNSVE SDLCHLTWTP DDSDTWDCPS FLWDMN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A5e-23131172105MYB PROTO-ONCOGENE PROTEIN
1msf_C5e-23131172105C-Myb DNA-Binding Domain
1mse_C5e-23131172105C-Myb DNA-Binding Domain
1h89_C1e-22511749159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-22511749159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009377046.11e-172PREDICTED: transcription factor MYB59-like
TrEMBLM5VUK71e-127M5VUK7_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.16e-48myb domain protein 27